» »

Lebensmittelunverträglichkeitstest - viele Fragen bzgl Ernährung

Sechni&tze"lwie nexr hat die Diskussion gestartet


Liebe Community!

Ich schreibe im Namen meiner Freundin, um uns einen zweiten Account zu ersparen!

Sie hat Gestern ihren Lebensmittelunverträglichkeitstest zurück bekommen, Grund war ihre äußerst schlechte Haut im Gesichtsbereich, keine Akne, aber viele kleine Pickel, also einfach unreine Haut. Die unreine Haut hat Sie seit Sie die Pille wieder abgesetzt hat, jene hat Sie auch schon aufgrund der schlechten Haut verschrieben bekommen. Das war ca. vor 1 1/2 Jahren (Pille abgesetzt), seit dem hatte sie eine Medikamentenkur, leider weiß ich dass Medikament nicht mehr, darauf wurde es für ca. 6-8 Monate besser, bzw. war es dann ganz weg. Diesen Sommer ist es dann wieder schlimmer geworden.

Meine Freundin ist 24 Jahre alt, damit das auch mal gesagt ist. ;-)

Wie bereits erwähnt hat Sie dann einen Lebensmittelunverträglichkeitstest (bumm, langes Wort :-D ) gemacht und nun die Ergebnisse bekommen.

Dabei gibt es drei Unterteilungen:

0-23 ist im normalen Bereich

24-29 mit leichtem Intoleranzspielgel

und >30 mit erhöhtem Intolerantspiegel

Dabei sind folgende Ergebnisse rausgekommen.

Milch (Kuh) >160

Eiweiß 152

Kartoffel 139

Reis 97

Casein 72

Milch (Schaf) 56

Sojabohne 46

Eigelb 33

um die wichtigsten zu nennen.

Wie würdet ihr jetzt damit umgehen? Das Milch auf der Liste ist, ist nicht ganz überraschend, weil Ihre Schwester eine Laktoseintoleranz hat, jedoch hat meine Freundin überhaupt keine Verdauungsprobleme, sonder hat den Test wirklich nur wegen Ihrer Haut gemacht.

Auch Milch zu verzichten ist nicht das große Problem. Wir haben jetzt mal für den Kaffee eine Kokosmilch gekauft, weil Sie auf die Sojabohne ja ebenfalls intolerant reagiert. Können wir damit mal alle Soja-Produkte prinzipiell ausschließen?

Meine Thread ist schon relativ unübersichtlich, deshalb fasse ich die wichtigsten Fragen zusammen.

1. Kann die schlechte Haut von der Milch, bzw. Milchprodukten kommen?

2. Wie soll meine Freundin mit dem Wert "Eiweiß" umgehen, es ist für uns etwas unverständlich, warum Sie hier eine hohe Unverträglichkeit hat, jedoch keine Unverträglichkeit für sämtliche Fleischsorten aufweißt.

3. Kann meine Freundin noch 2-3 Eier in der Woche essen, oder sollte Sie auch hier zurückschrauben?

4. Wie schaut es mit Reis aus, wir essen ziemlich viel Persisch, und da ist Reis schon ein grundlegendes Lebensmittel.

Wäre euch dankbar für eure Antworten! ;-D ;-D ;-D

Antworten
t]hofoxer


Wer hat denn diesen Lebensmittelunverträglichkeitstest durchgeführt? Ein Arzt?

SIchn+itz<elawixener


Ein Labor, auf das Ansuchen Ihres Hausarztes, Sie hat am Freitag eh ein Gespräch mit jenem Arzt, es wäre nur interessant zu wissen was das Forum so dazu sagt!

lg

U"serW7394x8


was sind das für Werte? IgE? ODer IgG (was dann garkeine Aussagekraft hätte, denn diese zeigen nur, dass das Immunsystem kontakt damit hatte! ) Oder wurde eine Maldigestion (ungenügende Verdauung) getestet?

1. Kann die schlechte Haut von der Milch, bzw. Milchprodukten kommen?

Ja, aber auch von Allergien, Gluten(sensivität), sonstigen Unverträglichkeiten, Parasitosen, Reizungen etc.

2. Wie soll meine Freundin mit dem Wert "Eiweiß" umgehen, es ist für uns etwas unverständlich, warum Sie hier eine hohe Unverträglichkeit hat, jedoch keine Unverträglichkeit für sämtliche Fleischsorten aufweißt.

Damit ist wohl Eiklar gemeint

Eine Laktoseintoleranz wird durch einen Enzymmangel hervorgerufen und hat nicht mit einer Unverträglichkeit zu tun!

Lebensmittelunverträglichkeitstest (bumm, langes Wort :-D )

Ich sag nur Oberweserdammschifffahrtsgesellschaftskapitänsmützenknopfanhängungsfadenspitzenverdrehung

;-)

SJchnitHzelwRieBner


Hello User73948!

Es handelt sich um einen Foodprint 200+ Test! Habe jenen gegoogelt und folgende Seite dazu gefunden.

[[http://www.camnutri.com/foodprint-p-44.html?detail=1&cPath=21]]

Auf dieser Homepage ist immer die Rede von IgG. IgE wird nicht erwähnt(habe die Seite durchsucht)

Die Werte sind mit U/ml angeben. Scheint diese Enzymeinheit (U) zu sein.

Das es sich beim Eiweiß um das Eiweiß im Ei handelt, da waren wir anscheinend zu dumm dafür ;-D ;-D ;-D !

Kannst du deine Aussage "ODer IgG (was dann garkeine Aussagekraft hätte, denn diese zeigen nur, dass das Immunsystem kontakt damit hatte!" präzisieren, weil daweil werde ich nicht schlau daraus.

Weiters würde ich gern wissen, wie wir mit den Werten nun umgehen sollen? Sind 1-2 Eier in der Woche trotzdem ok, wenn keine Magenbeschwerden auftreten? Steckt der Körper das alles weg(vom Fall ausgehen, dass die schlechte Haut nicht von den Eiern kommt, weil dann würde meine Freundin wohl sowieso darauf verzichten)

Ich danke euch für eure Hilfe!

lg SW

U4s2er7E3948


Der Punkt ist folgender, ich versuche dir das mal verständlich zu erklären. Es gibt verschiedene Arten/Klassen von Antikörpern (=Immunoglobine). IgA (vor allem gegen Bakterien, Viren, die Arbeiten auf zellulärer Ebene, heißt sie zerstören grob gesagt Körpereigene Zellen (da diese Viren und manche Bakterien ohne eigenen Stoffwechsel zu Vermehrung nutzen), diese sind auch bei Autoimmunkrankheiten (Körper zerstört sich selbst) entscheidend. Dann gibt es IgM diese arbeiten gegen alle eindringenden Mikroorganismen (Bakterien, Viren, Protozoen etc..). Außerdem IgE. Diese sind eigentlich gegen größere Organismen (Parasiten) gerichtet und lösen auch alle Allergien aus! Sie nehmen aber trotzdem nur einen kleinen Teil der IG AK ein. Dann gibt es noch IgG die sind praktisch die Polizei im Immunsystem. Sie kontrollieren Reaktionen und lösen nur selten selber welche aus. Diese werden sofort gebildet wenn man mit einem Eiweiß (Protein) in Kontakt kommt! Bei einer Hyposensibilisierung beispielsweise wird erreicht, dass statt IgE AK vermehrt IgG gebildet wird. Das führt zu weniger IgE (=weniger Reaktion) und gleichzeitig eine regulierung der Immunreaktion!

IgG Tests werden von vielen Heilpraktikern angeboten, haben aber KEINE Aussagekraft, ob ein Stoff wirklich ein Problem darstellt. OFt wird wie bei dir eine elend lange Liste gefunden und es werden Diätempfehlungen ausgesprochen, die langfristig zu Nährstoffmängeln führen müssen. Es werden damit zwar Erfolge gefeiert, aber nur weil das Lebensmittel zufällig dabei war (wäre es bei dir z.B. die Milch). LAsst mich raten.. ihr esst häufig Milch, Ei, Kartoffeln und Reis? Wenn ja - siehst jetzt warum!

Wo die Probleme herkommen lässt sich wenn, nur mit einem Test auf IgE Reaktionen machen (Prick, Blut, Provokation etc. ). ICh denke aber kaum, dass eine Lebensmittelallergie dahintersteckt, wenn keine Verdauungsprobleme da sind!! Schonmal einen Allergietest auf Umweltallergene gemacht? Treten die BEschwerden zu unterschiedlichen Jahreszeiten unterschiedlich stark auf? Es könnte aber auch eine Fructoseintoleranz oder GLutensensivität sein. Das würde ich aber eher später machen. Testet auf jeden Fall mal den Gesamt IgE Spiegel und die Eosinophilen, oft steckt hinter sowas auch ein Parasit (Würmer, etc).

SAch.nitzel7wVienexr


Danke für deine ausführliche Antwort!

Meine Freundin war jetzt bei ihrer Ärztin, sie meinte sie solle eine Gastroskopie machen, weil sie vermutet Zöliakie.

Sie meinte auch, dass die schlechten Werte eventuell davon kommen und sich dann wieder einspielen werden, wenn sie auf Gluten verzichtet.

Die Frau Doktor hat auch gesagt, dass es eventuell nur eine vorübergehende Unverträglichkeit auf Gluten ist, aber mal schauen. Meine Freundin geht gut damit um, es wäre nicht der Weltuntergang, weil wir im Alltag gut darauf verzichten könnten. Im Urlaub wäre es wohl etwas anstrengend, aber was soll man machen, man kann nicht alles haben ;-) ! ;-D

UZser7[3x948


Welche schlechten Werte? Wie gesagt, die IgG Werte haben keinerlei aussagekraft. Wie kommt ihr auf Gluten? Symptombedingt? Da bedeutet ein negatives Ergebnis nur, dass man keine Autoimmunerkrankung hat - Sensivität mit gleichen Symptome kann es trotzdem geben!

Sechnxitzeblwiexner


Hello, also die Werte sind ja wsh IgG Werte, weil bei diesen Foodprint 200 Wert nur diese IgG erwähnt wird.

Meine Freundin hat sehr schlechte Werte, also viele Lebensmittel im roten Bereich, vor allem Milchprodukte und Glutenhaltiges Getreide.

Auf Gluten kommt die, weil eine Glutenunverträglichkeit ja den Darm beschädigt, und es somit die Mangelerscheinungen von Eisen und Zink erklären wurde, in weiterer Folge auch den Haarausfall und die schlechte Haut. Gleichzeitig meint sie, dass wenn meine Freundin auf Gluten verzichtet, der Darm wieder gut wird, und sich die anderen "Unverträglichkeit" wie Milchprodukte wieder einspielen könnten. Also dass der Darm dann keine Probleme mehr mit Milchprodukten hat.

Typische Sympthome hat sie jetzt nicht wirklich, sie hat keine Verdauungsbeschwerden oder ähnliches.

Glaube es geht eher um die Mangelerscheinungen bei ihren Eisen und Zink werten, die sehr schlecht sind.

Mal schauen was bei der Gastro rauskommt

Utser7~39x48


Eisen und Zinkmangel haben mMn niemals zwingend was mit Unverträglichkeiten oder Malabsorption zu tun. Unsere heutige Ernährung ist einfach viel zu Nährstoffarm. Ich empfehle deshalb jedem ein Zink sowie Magnesiumpräperat einzunehmen, auch wenn kein erkannter Mangel vorliegt. Diesen kann man auch nicht einfach feststellen! Zinkmangel ist einer der häufigsten in Europa! Über 60%! Und oft der Auslöser für Hautprobleme. MAch doch mal einen Zinkgeschmackstest.. [[http://www.allergien-behandeln.de/zinkgeschmackstest/]]

Wenn sie nicht bei Stufe 4 ist hat sie einen MAngel! Wenn sie bei 4 ist, ist ein Mangel auch nicht unmöglich, da sie Hautprobleme hat! Ich würde empfehlen 15mg elementares Zink/Tag (Citrat am besten), sowie 200-400mg elementares Mg (ebenfalls Citrat o.ä.) zu nehmen + Eisen, das kann man mit den Ärzten besprechen. 200-2500IU Vit. D3 pro Tag wären auch angebracht!

Wie gesagt, diese IgG Werte sagen leider nix aus..

nMajaCnaguxt


Was einem auch keiner vorher verrät: Die Antikörpertests zeigen bevorzugt hohe Reaktionswerte bei Lebensmitteln, von denen man in den Tagen vorher viel gegessen hat.

Wisst ihr noch, was deine Freundin in den 2-3 Tagen vor dem Test gegessen hat? Sollten das genau die Dinge sein, auf die sie angeblich stark reagiert, könnt ihr die Ergebnisse in die Tonne kloppen. Sind bei den hohen Werten auch Sachen dabei, die sie nicht vorher gegessen hat, würde ich diese Lebensmittel nochmal abtesten und dann ggf. weglassen.

BHillCyNixk


Die unreine Haut hat Sie seit Sie die Pille wieder abgesetzt hat, jene hat Sie auch schon aufgrund der schlechten Haut verschrieben bekommen.

Dann würde ich eher von Hormonstörungen ausgehen. Läge es an der Ernährung, hätte es unter Pilleneinnahme keine Verbesserung gegeben.

Das Milch auf der Liste ist, ist nicht ganz überraschend, weil Ihre Schwester eine Laktoseintoleranz hat, jedoch hat meine Freundin überhaupt keine Verdauungsprobleme, sonder hat den Test wirklich nur wegen Ihrer Haut gemacht.

Der Test sagt überhaupt nichts über eine mögliche Laktoseintoleranz aus.

IGG-Tests ansich sind sehr umstritten. Aber das wurde dir ja bereits näher erklärt.

Bzgl. Zöliakie könnte deine Freundin sich ein wenig belesen, ob die Symptome zutreffen. Sollte sie die Magenspiegelung mit Dünndarmbiopsie machen, muss für eine sichere Diagnose auch ein Bluttest erfolgen. Nur Bluttest oder Magenspiegelung reicht nicht aus.

S6chn6itXzelwbixener


Sie hat am Mittwoch die Magenspiegelung und dann werden wir weiterschauen, was die Herren und Damen von sich geben werden.

Ich danke euch für eure zahlreichen Meinungen und werde mich wieder am Mittwoch mit neuen Infos melden, hoffe ihr meldet euch dann auch wieder ! :)^ :)^ :)^

SBchnitzeplwixener


Lieber Mitleser!

Gastroskopie ist vorbei! Proben sind versendet, endgültigen Befund erhalten wir leider erst in zwei Wochen per Post. Somit auch die endgültigen Beurteilung bzgl. Zoeliakie.

Auf dem vorläufigen Befund steht bisher nur folgendes:

Oesophagus: unauffällig, keine Refluxzeichen

Cardia: unauffällig

Fundus ventriculi: unauffällig

Corpus ventriculi: unauffällig

Antrum ventrucli: fleckförmig Rötung der Schleimhaut wie bei chronischer Gastritis, minimal

Bulbus duodeni: unauffällig: makroskopisch keine Schleimhautatrophie

Pars desc. duoden: unauffällig, inkl. Papillia major o.B, makroskopisch keine Schleimhautatrophie

Beurteilung: Vollständige ÖGD:

Bis auf Zeichen einer geringgradigen chronischen Antrumgastritis unauffälliger Befund.

Scheint jetzt als Laie auf ersten Blick insgesamt nicht so schlimm zu sein.

Habt ihr Meinungen dazu?

Danke! :)

U-ser7x3948


DAs heißt ihr habt jetzt eine Magenspiegelung gemacht wegen schlechter Haut? Naja.. jeder wie er meint. Macht doch mal einen Test auf Zinkmangel. Hier: [[http://www.allergien-behandeln.de/zinkgeschmackstest/]] Ich denke nicht, dass es an Lebensmitteln liegt, muss ich ehrlich sagen.

Wollen Sie selber etwas dazu schreiben?

Dann melden Sie sich an bzw. lassen Sie sich jetzt registrieren, das ist kostenlos und innerhalb weniger Minuten erledigt. Interessant sind sicher auch die übrigen Diskussionen des Forums Ernährung oder aber Sie besuchen eines der anderen Unterforen:

Übergewicht · Unter­gewicht · Magen und Darm · Zahnmedizin · Suchtprobleme


Nicht angemeldet: Anmelden | Registrieren | Zugangsdaten vergessen? | Hilfe

Startseite | Impressum | Nutzungsbedingungen | Netiquette | Datenschutz   © med1 Online Service GmbH